Welcome to Gemlite Soap & Candle Supply, International Parallel Machines Inc.
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Our Products
Cart
0
Product Details
Scent Sample Pack

Scent Sample Pack

Product Code: FC-02
Brand: Gemlite
Product Condition: New
weight: 6.0oz
$11.00
$7.99 inc. tax
 Add to Cart
Description

Many of you have expressed an interest in sampling Gemlite fragrance concentrates without having to invest in the purchase price of pound size bottles. Now you can evaluate our fragrance oils by purchasing a low-cost Sampler Set of 5 (0.5 ounce/half-ounce) bottles of ANY  fragrance concentrate you choose.*
​
We encourage people to try our wholesale fragrances and have made it very easy for you to do exactly that! With this "PICK FIVE" Sampler Set, you'll soon learn why professional chandlers and soap-makers everywhere have embraced Gemlite for their fragrance needs.

Select any FIVE oils and click the "Add to Cart" button to complete sample order. Multiples of the SAME fragrance are not permitted.

Includes: 5 - half-oz Fragrance Concentrate samples in elegant Glass bottles
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i